PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00755.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 339aa    MW: 36116.1 Da    PI: 4.2993
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00755.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161663148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00755.1.g00320.1.sm.mk 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                                  89******************************99************97 PP

2Myb_DNA-binding51.52.4e-1669114148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T++E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Zmw_sc00755.1.g00320.1.sm.mk  69 RGNFTADEEETIIKLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                                   89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.361163IPR017930Myb domain
SuperFamilySSF466891.43E-2913110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002493.4E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231770IPR009057Homeodomain-like
CDDcd001672.00E-101863No hitNo description
PROSITE profilePS5129424.72164118IPR017930Myb domain
SMARTSM007173.9E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2671118IPR009057Homeodomain-like
CDDcd001677.90E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEETI IKLHGLLGNK WSKIAACLPG RTDNEIKNVW NTHLKKKVAQ  120
REQKKEEGSE PISSSSASSS TTTANSSGDA GEQCGTSKEP DAADTIPPVE TDIDIYDMLV  180
DAFPAAAEPM PPSSPCSSST LTTCVVGVDD LIELPVIDIE PDIWSIIDGD GGADVPDVSG  240
ARHGDAAVPC TGAGVSTSGE AGEASDWWLA NLEKELGLWG PTEDSQAQGD TEGPGANLEM  300
GFAVALGDAE GDPVSTYFQS GPTSIELPED ESFSLTREC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-27141182105C-Myb DNA-Binding Domain
1msf_C2e-27141182105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953532.11e-142PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-144MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0A9HFK41e-148A0A0A9HFK4_ARUDO; Uncharacterized protein
STRINGGRMZM5G833253_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798